Description
Gene Model Namecajca.C.cajan_07765
Micro Synteny Viewcajca.C.cajan_07765
OrganismCajanus cajan (pigeonpea)
Assembly versioncajca.ICPL87119.gnm1
Gene Model Buildcajca.ICPL87119.gnm1.ann1
Gene Familylegfed_v1_0.L_1X7X83
DescriptionGATA type zinc finger transcription factor family protein; IPR001781 (Zinc finger, LIM-type); GO:0008270 (zinc ion binding)
Protein domainsG3DSA:2.10.110.10 PF00412 PS00478 PS50023 PTHR24206 PTHR24206:SF18 SM00132 SSF57716
mRNA and protein identifiers
(also see Sequences tab)
cajca.C.cajan_07765.1

Sequences
Gene Model Namecajca.C.cajan_07765
This gene model has 1 associated mRNAs
mRNA Sequence

cajca.C.cajan_07765.1 sequence

>cajca.C.cajan_07765.1
ATGGCCAGTTTTGCAGGAACCACACAGAAGTGCATGGCATGTGAGAAAAC
TGTCTACCTTGTTGATAAGCTAACTGCTGATGGCCGTATCTTTCATAAGG
CCTGCTTCCGATGCCACCATTGCCGCAGTACCCTTAAGCTTAGCAACTAC
TGTTCTTTTGAGGGGGTGCTCTACTGCAGACCTCACTATGATCAACTCTA
CAAGAGAACTGGCAGCCTGGACAAAAGCTTCGAAGGAACACCAAAAATTC
AGAAACCAGAGAAACCGATCACTGATAATGAGAATACAAAGGTGCTCGCA
AACGTGTTCTTGGGCACCAGAGATAAGTGTGTGTGTTGCAAAAAGACAGT
GTATCCCACTGAGAGGATTACTATTAATGGGACTCCATACCACAAGAGCT
GCTTCAAGTGCACCTATGGAGGTTGTACTATAAGCTCATCAAACTTCATC
ACACACGAGGGAAAGCTGTACTGCAAGCATCACCACATTCAACTCTTCAA
GGAGAAGGGCAATTACAGTCAGCTCGAGAATGACCAAGTTGCTACCACGG
ATGTCTCTGCTTAA
back to top
Protein Sequence

cajca.C.cajan_07765.1 sequence

>cajca.C.cajan_07765.1
MASFAGTTQKCMACEKTVYLVDKLTADGRIFHKACFRCHHCRSTLKLSNY
CSFEGVLYCRPHYDQLYKRTGSLDKSFEGTPKIQKPEKPITDNENTKVLA
NVFLGTRDKCVCCKKTVYPTERITINGTPYHKSCFKCTYGGCTISSSNFI
THEGKLYCKHHHIQLFKEKGNYSQLENDQVATTDVSA
back to top
Expression
Available datasets: